BOOKS with Alphabet P (Pa, Pb,Pc, Pd, Pe…... )

Overview: Presents an integrated focus on health care and sustainability.Provides practical strategies and solutions.Discusses case studies and examples.This book is a groundbreaking book that delves into the critical intersection of health care and sustainability. As the healthcare industry faces increasing scrutiny regarding its environmental impact, this comprehensive guide offers a roadmap for transforming healthcare systems into sustainable entities that prioritize the health of both individuals and the planet...Drawing on a multidisciplinary approach, the book explores the environmental

Overview:

Overview: Novel approaches for design and analysis of robust motion control and state estimation of mechanical systems.Includes supplementary material: .This monograph investigates a practical way to achieve robust motion control and state estimation (Kalman filtering) of mechanical systems, which is a promising approach in terms of the perturbation compensator. The book presents novel approaches for design and analysis of perturbation observers as well as an extension to robust motion control and robust state estimation. The book is written in a self-contained manner including experimental re

Overview: This book constitutes the refereed proceedings of the 9th International Conference on Persuasive Technology, PERSUASIVE 2014, held in Padua, Italy, in May 2014. The 27 revised full papers and 12 revised short papers presented were carefully reviewed and selected from 58 submissions. In addition to the themes of persuasive technology dealt with in the previous editions of the conference, this edition highlighted a special theme, i.e. persuasive, motivating, empowering videogames.978-3-319-07126-8978-3-319-07127-5Series ISSN 0302-9743 Series E-ISSN 1611-3349

Overview: There is a void of books on the economics of precision agriculture, no similar books have been published.A farm business management mental framework of approach lends itself to a broad target audienceThis book presents cases from different countries with a main focus on the perspectives of using precision farming in Europe. ?Divided into 12 chapters it addresses some of the most recent developments and aspects of precision farming. The intention of this book is to provide an overview of some of the most promising technologies with precision agriculture from an economic point of view.

Overview: Wirtschaftswissenschaftliche Studie.Includes supplementary material: ?Sandra Dorobek geht in ihrer Dissertation der Fragenach, inwieweit auch ?ffentliche Wertsch?pfungsketten mittels klassischerprivatwirtschaftlicher Managementkonzepte (hier: mithilfe des SCM-Ansatzes) gesteuert werden k?nnen, so dass die Gesellschaft als Adressat der politisch gewünschten ?ffentlichen Leistung von den damit verbundenen Effizienzvorteilen profitiert. Die Arbeit leistet einen grundlegenden Beitrag zur Weiterentwicklung des SCM-Ansatzes zu einem Public SCM für die Steuerung ?ffentlicher Wertsch?pfungsk

Overview: Explores how Pinewood came to be Britain’s dominant film studios, focusing on the key years 1936-55.Provides a new approach to a particular aspect of British film history.Analyses 12 important British.This open access book examines how Pinewood came to be Britain’s dominant film studio complex, focusing on key years following the Second World War. It presents a revisionist, micro history of the studio and its longevity during a particularly turbulentperiod, explaining Pinewood’s survival at a time when other major film studios such as Denham closed. This book also provides contempora

Overview: Wichtig für Projektverantwortliche: Einblick in die verschiedenen Spannungsfelder in der Projektarbeit.Praxisrelevant: mit Hinweisen zur produktiven und nachhaltigen Gestaltung der ProjektleitungsrollProjektleitende erleben vielf?ltige Spannungsfelder in ihrer Arbeit und sind dabei besonders exponiert. Das Buch erkl?rt die verschiedenen Spannungsfelder, denen Projektverantwortliche ausgesetzt sind und zeigt, wie ein nachhaltiger Umgang über Grenzmanagement gelingen kann, damit die anspruchsvolle Aufgabe mit Freude, Erfolg und bleibender Gesundheit erledigt werden kann. Praktische Hin

Overview: The only book that gives such a broad overview of protein-protein interactions and their importance.Provides a complete view of the field by addressing issues on protein-protein interactions from theiGabriel Waksman Institute of Structural Molecular Biology, Birkbeck and University College London, Malet Street, London WC1E 7HX, United Kingdom Address for correspondence: Professor Gabriel Waksman Institute of Structural Molecular Biology Birkbeck and University College London Malet Street London WC1E 7H United Kingdom Email: g. waksman@bbk. ac. uk and g. waksman@ucl. ac. uk Phone: (+4

Overview: Das erfolgreiche Patterns-Praxisbuch als vollst?ndig aktualisierte 5. Auflage.Erfolgreiche Softwareentwicklung im kompakten Taschenbuch-Format.Für fortgeschrittene Softwareentwickler ein Must-have.EinPatterns kompakt fasst die wichtigsten Entwurfsmuster zusammen, die Sie für Softwareentwicklung ben?tigen. Softwareentwickler und -architekten finden darin effektiv anwendbare L?sungen für t?gliche Entwurfsprobleme.?.Das Buch gliedert Patterns anhand typischer Aspekte des Softwareentwurfs:?.- Basismuster für mehr Flexibilit?t und Wartbarkeit.- Pr?sentation.- Kommunikation und Verteilung.

Overview: Distributing power in high speed, high complexity integrated circuits has become a challenging task as power levels exceeding tens of watts have become commonplace while the power supply is plunging toward one volt. This book is dedicated to this important subject. The primary purpose of this monograph is to provide insight and intuition into the behavior and design of power distribution systems for high speed, high complexity integrated circuits.978-1-4613-5057-6978-1-4615-0399-6

Overview: 978-94-010-6920-5978-94-009-0957-1

Overview: Uniquely uses healthcare initiatives as a variable in presidential rhetoric.Provides an international perspective to healthcare reform.Related to key current issues such as Obama’s Patient Protection .This book analyzes the rhetorical strategies employed by the four Democratic presidents, Truman, Johnson, Clinton and Obama, who tried to expand access to and affordability of healthcare in the United States. It considers how they made such arguments, the ethics they advanced, and the vision of America they espoused. The author combines rhetoric analysis, policy analysis, and policy his

Overview: Biological processes in the oceans play a crucial role in regulating the fluxes of many important elements such as carbon, nitrogen, sulfur, oxygen, phosphorus, and silicon. As we come to the end of the 20th century, oceanographers have increasingly focussed on how these elements are cycled within the ocean, the interdependencies of these cycles, and the effect of the cycle on the composition of the earth‘s atmosphere and climate. Many techniques and tools have been developed or adapted over the past decade to help in this effort. These include satellite sensors of upper ocean phytop

Overview: An essential textbook for both marketing professionals and students on business studies and marketing degree courses. One of the only books designed to show marketing professionals how to successfullyPublic relations can make or break a company. A well-planned campaign can multiply marketing effectiveness, whilst badly managed public relations can destroy products...or even close companies!An experienced professional in the field of business communications, Roger Haywood shows how to improve marketing effectiveness through good public relations.Eminently practical, it provides numero

Overview: Selected papers from the 3rd NICFD conference.Presents theoretical, computational and experimental aspects.Gas-dynamics and flows.This book contains a collection of the main contributions from the third edition of the NICFD conference, organized by the Special Interest Group on Non-Ideal Compressible Fluid Dynamics (SIG-49). It provides insight on the latest research findings in the field of NICFD that are relevant to a number of engineering applications related to the conversion of renewable and waste energy sources, like organic Rankine cycles, supercritical CO.2. cycle power plant

Overview: In diesem Band sind unterschiedliche Forschungsbeitr?ge zur "Medien?sthetik" versammelt. Im Mittelpunkt stehen die tiefgreifenden gesellschaftlichen Ver?nderungen, die durch die neuen Medien bewirkt worden sind. Sie werden anhand typischer Zeiterscheinungen - wie z.B. Techno, das Casting oder auch die "Lindenstra?e" - aus erziehungswissenschaftlicher Perspektive betrachtet.978-3-8100-2474-9978-3-322-97453-2

Overview: Im vorliegenden Buch wird eine neue EMV-Filterma?nahme eingeführt, die auf dem piezoelektrischen Effekt basiert. Piezoelektrische EMV-Filter (PEF) erzeugen bei ihren Resonanzfrequenzen einen niederimpedanten Ausbreitungspfad für leitungsgebundene elektromagnetische St?rungen. Dies erm?glicht eine Unterdrückung diskreter St?rspitzen. Jenseits der Resonanzen verhalten sich PEF kapazitiv. PEF k?nnen daher nicht nur regul?re Funkentst?rkondensatoren, wie z.B. Y-Kondensatoren, ersetzen, sondern erm?glichen zus?tzlich eine selektive D?mpfung bei dezidierten St?rfrequenzen. Es wird gezeigt,

Overview: Pattern recognition is traditionally considered to cover all aspects of sensory data perception ranging from data acquisition, through preprocessing and low level analysis, to high level interpretation. Owing to its breadth and important application potential, the field of pattern recognition has been attracting considerable attention of researchers in academia and industry and consequently it has been witnessing a rapid growth and perpetual development. The need for dissemination of the latest results is being served by a host of international conferences on pattern recognition. One

Overview: Up-to-date review of number of topics in the area of protein science.Contributions from a broad range of research areas.Chapters on a variety of proteins, techniques and model systems.The aim of the .Protein Reviews. is to serve as a publication vehicle for review articles that focus on crucial current vigorous aspects of protein structure, function, evolution and genetics. The volumes will appear online before they are published in a printed book. Articles are selected according to their importance to the understanding of biological systems, their relevance to the unravelling of iss